DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP006489

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_557171.2 Gene:AgaP_AGAP006489 / 3290176 VectorBaseID:AGAP006489 Length:278 Species:Anopheles gambiae


Alignment Length:277 Identity:58/277 - (20%)
Similarity:96/277 - (34%) Gaps:90/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEA----PPKWVRIGDLDLASEKR 213
            ||:|.:..|....:    :..|.|::|:...|||:|.|...|:.    |.:.||:...|::....
Mosquito    30 GEFPSVVRVKTPRE----NQFCLGTVINSNHVLTSAFCVLSYDRMRIFPARLVRVIGGDISVTPA 90

  Fly   214 SVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVEL-----TEYVRPVRLWVFPEL-PTTIAF 272
            ::..|....:.:|.|.:|:...|.:::|:::|.:...|     .|.|  :|:.:.||. |..:  
Mosquito    91 AITRQTRTGQHIFVHEDYRPHTYENNLAIIRLAEPFHLPSNAIEEAV--IRMRIVPEQHPCDV-- 151

  Fly   273 AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDS 337
            ...|.|                   |..|.|         ||..:..|......|.|||.|..: 
Mosquito   152 VTWYRA-------------------PGTEGN---------PSQEIPRQQAFNVNIRNRDVCAAE- 187

  Fly   338 GGPLQLNLPGRRRGHRIHYHLI---GITSYGV------FCRSSYPS------------------- 374
                      ||....:..:.:   ..|:.||      ||.....|                   
Mosquito   188 ----------RRTEFTLEENSLCTYTTTTIGVVQGDPMFCDGELTSIQSYVFLPPVTGQPQPQPQ 242

  Fly   375 -----VYTRVSSFLDWI 386
                 |.|:|..:|.||
Mosquito   243 NQPNLVSTQVRFYLHWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 58/277 (21%)
Tryp_SPc 146..386 CDD:214473 56/275 (20%)
AgaP_AGAP006489XP_557171.2 Tryp_SPc 30..225 CDD:304450 52/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.