DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:297 Identity:87/297 - (29%)
Similarity:131/297 - (44%) Gaps:55/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QKYSEYVERIFP------NDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGS 177
            :::..|..|:.|      |||:.....|..:      |.||::|:..|:......|..  .||||
Mosquito    32 EEFDHYWARLPPELQVYRNDTSTDRVVNGQE------ALPGQFPYQVALLLNFPDGTA--LCGGS 88

  Fly   178 LISERFVLTAAHCTSIYEAPPKWVRIGDLDL--ASEKRSVEAQLLRIE----QVFAHPNYKKKMY 236
            :::..|:||||||.|   |....:..|.:.:  |..:.::|....||.    .:..||.|.....
Mosquito    89 VLTRNFILTAAHCVS---ATSTTLVSGGIAIMGAHNRTAMELSQQRIRFTSTGIRRHPEYDDTSL 150

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF------AMGYGATSFAKPMTNRLTNLNLT 295
            .:|:||:.|...:..|..|:|:.|   |....|..|      ..|:|.:|.|.|..:.:  |..|
Mosquito   151 RNDVALILLNSPMTFTSRVKPISL---PARTDTRQFEGFTGTVSGFGRSSDASPYPSSI--LRFT 210

  Fly   296 ---VVPNAECNAELPPLAETPSGVLESQ-ICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHY 356
               ::..|||      :......:.:|| :|.:. ...|.:|.|||||||.:|..|..:      
Mosquito   211 SNPIMSKAEC------IVSWGFALAQSQNVCLKP-TGGRSSCNGDSGGPLTVNSGGVLQ------ 262

  Fly   357 HLIGITSYG--VFCRSSYPSVYTRVSSFLDWIELTVW 391
              ||..|:|  ..|.|.:||||.|||.||.||...:|
Mosquito   263 --IGTVSFGSSYGCASGWPSVYARVSYFLSWINENIW 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/258 (30%)
Tryp_SPc 146..386 CDD:214473 77/257 (30%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 78/266 (29%)
Tryp_SPc 57..295 CDD:238113 80/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.