DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and AgaP_AGAP005642

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_556287.3 Gene:AgaP_AGAP005642 / 3290013 VectorBaseID:AGAP005642 Length:313 Species:Anopheles gambiae


Alignment Length:302 Identity:79/302 - (26%)
Similarity:132/302 - (43%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRV---LARP-GEYPHMAA-----------VGFE-----------SDRGQVDY 172
            |.|...:.|.|.|.:   ..|| .|:||:||           .||:           :..||:.|
Mosquito    19 AAAGLVDGARFQGTIDWSRVRPLSEFPHIAARVDQLKKVQLDEGFKAPSARIVGGSIATAGQIPY 83

  Fly   173 K-------------CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIE- 223
            :             |||.|:|..|||||..|  :.......|.:|.|:|.:|   .||..:||. 
Mosquito    84 QVAILSDLEAGQALCGGVLLSNNFVLTAGVC--VENTSGGVVVLGALNLQNE---AEAGQVRITF 143

  Fly   224 ---QVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT---TIAFAMGYGATS-F 281
               .|..|..:...::.::||.::|.:.|..::.::|||:....:..|   .:|...|:|.|| .
Mosquito   144 AAGDVRLHEEFLAVIFRNNIAAIRLSEPVSFSDRIQPVRIPAAADGRTFAGALATVSGFGRTSDS 208

  Fly   282 AKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLP 346
            :...::.|..:...::.||:|      .|....|:::.|.....|:..|..|.||.|||:.:...
Mosquito   209 STSFSDVLRYVRNPIMTNADC------FATAWGGLIDGQKMCLHYMEARAPCDGDVGGPMTVADG 267

  Fly   347 GRRRGHRIHYHLIGITSYG--VFCRSSYPSVYTRVSSFLDWI 386
            |...       |:|:.|:|  :.|.|.:|:|:.|::.:..||
Mosquito   268 GSTL-------LVGLYSFGSVLGCESDWPAVFVRITFYRQWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/290 (26%)
Tryp_SPc 146..386 CDD:214473 73/288 (25%)
AgaP_AGAP005642XP_556287.3 Tryp_SPc 69..302 CDD:214473 63/250 (25%)
Tryp_SPc 70..302 CDD:238113 63/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.