DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss34

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:244 Identity:73/244 - (29%)
Similarity:119/244 - (48%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVR--IGDLDLASEKRSVEAQLLRIEQV 225
            ::.:..:.:::||||||..::|||||||....|.....||  :|.|.|....     ||:::.::
Mouse    55 YDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQLRLYEND-----QLMKVVKI 114

  Fly   226 FAHPNYKKKMYY---DDIALLKLEKEVELTEYVRPVRLWVFPELPTTIA-----FAMGYGATSFA 282
            ..||.:.:|:..   .|||||||:..|.|:|:|.||.|   |.....|:     :..|:|.....
Mouse   115 IRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSL---PAASLRISSKKTCWVAGWGVIENY 176

  Fly   283 KPM--TNRLTNLNLTVVPNAECNAELPPLAETPSG---VLESQICAQDYILNRDTCQGDSGGPLQ 342
            .|:  ...|..:.:.:|.|.:|..:....:.:.|.   :.:..:||...  .||:|:.||||||.
Mouse   177 MPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCAGKE--GRDSCKADSGGPLV 239

  Fly   343 LNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            ..       ....:..:|:.|:|:.| ...:|.|||||.|::.||:..|
Mouse   240 CR-------WNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWIKCYV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/239 (30%)
Tryp_SPc 146..386 CDD:214473 70/238 (29%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 71/239 (30%)
Tryp_SPc 35..277 CDD:214473 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.