DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss4b

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:222 Identity:68/222 - (30%)
Similarity:105/222 - (47%) Gaps:29/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 YKCGGSLISERFVLTAAHC-TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM 235
            :.|||||:|..::::|||| |...:...:|..:     ..:.:.::...:.::.:..|.:|.:..
Zfish   225 HMCGGSLLSTSWIISAAHCFTGRTQELSRWTVV-----LGQTKVMDVVGVSVDMIVIHKDYNRLT 284

  Fly   236 YYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAF-----AMGYGATSFAKPMTNRLTNLNLT 295
            ...|||:|||...|:..|.:.||.|   |  |..:|.     ..|:|.......:...|...::.
Zfish   285 NDFDIAMLKLTWPVKTGESILPVCL---P--PHQLAIKDMLVVTGWGLLKEGGALPTVLQKASVP 344

  Fly   296 VVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIG 360
            :|..:||:.  |.:..  |.:....:||.....|.|.||||||||| :.|..|       :.|||
Zfish   345 LVNRSECSK--PTIYS--SSITPRMLCAGFLQGNVDACQGDSGGPL-VYLSSR-------WQLIG 397

  Fly   361 ITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |.|:||.| |...|.||..|:..||||
Zfish   398 IVSWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/222 (31%)
Tryp_SPc 146..386 CDD:214473 66/220 (30%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 66/220 (30%)
Tryp_SPc 202..427 CDD:238113 68/222 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.