DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG4653

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:111/260 - (42%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSI------YEAPPKWVRIGD 205
            |:.|..|..||..::     |....:.|||:||.|:::||||||.|:      |.|....||:|.
  Fly    28 RLPAEVGSQPHSISL-----RRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGS 87

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKK--MYYDDIALLKLEKEVELTEYVRPVRLWV-FPELP 267
            :     :|....||:.:.::..|.||...  :..:|:|||:||..|.|.....|:.|.. .|...
  Fly    88 I-----QRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAG 147

  Fly   268 TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAE----------LPPLAETPSGVLESQIC 322
            :.|.|: |:|::.....:::.|.......:..::|..|          |.|:.|..:|:      
  Fly   148 SQIIFS-GWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPVDEDFAGL------ 205

  Fly   323 AQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF-CRSSYPSVYTRVSSFLDWI 386
                      |.||:|.|...|           ..|:||.::.|. |.|..|..|..|:..|:||
  Fly   206 ----------CSGDAGAPASYN-----------NQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWI 249

  Fly   387  386
              Fly   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/260 (27%)
Tryp_SPc 146..386 CDD:214473 68/258 (26%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/258 (27%)
Tryp_SPc 30..249 CDD:214473 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.