DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG31827

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:291 Identity:77/291 - (26%)
Similarity:120/291 - (41%) Gaps:53/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SEYVERI---------FPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGS 177
            :|.||.:         :.|..||....|..  :|:  |:|.|:|...||  ..:|..|.   |||
  Fly    17 AENVENLQQIEELKCGYGNPDAVKVQFNVT--EGQ--AKPAEFPWTIAV--IHNRSLVG---GGS 72

  Fly   178 LISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIAL 242
            ||:...||||||.....:.....|..|:.:..|.......:...:.::..|.::..:...:::||
  Fly    73 LITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLAL 137

  Fly   243 LKLEKEVELTEYVRPVRLWVFP----ELPTTIAFAMGYGATSFAKP-MTNRLTNLNLTVVPNAEC 302
            |.|::|..||..:..:.|   |    .|.:|.....|:|...|:.. ....|..::|.:||...|
  Fly   138 LFLDREFPLTYKINTICL---PTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHIC 199

  Fly   303 NAELPPLAETPSGVLESQICAQDYILNR-----------DTCQGDSGGPLQLNLPGRRRGHRIHY 356
            ..:   |.:|..|        |:|.|.|           |.|.||.||.|...:....:    .:
  Fly   200 QDQ---LRKTRLG--------QNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPK----QF 249

  Fly   357 HLIGITSYGVFCR-SSYPSVYTRVSSFLDWI 386
            ..|||.::||.|: .:.|:.||.|..|..||
  Fly   250 EQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/258 (27%)
Tryp_SPc 146..386 CDD:214473 68/256 (27%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 69/254 (27%)
Tryp_SPc 50..280 CDD:214473 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.