DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG33159

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:269 Identity:86/269 - (31%)
Similarity:126/269 - (46%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 HMAAV------------GFESDRGQVDYK----------CGGSLISERFVLTAAHCTSIYEAPPK 199
            |:|.|            |.|:...:|.|.          |||||||.|.||:||||  :|.:.|:
  Fly    12 HLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHC--VYGSQPE 74

  Fly   200 WVRIGDLDLASEKRSVEAQLLRIEQVF-AHPNYKKKMYYDDIALLKLEKEVELT----EYVRPVR 259
            ...:   ...:.:...||.::|...:| ..|:|....:..|:|||:|::.|.||    ..:.|.|
  Fly    75 GFTV---HAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCR 136

  Fly   260 LWVFPELPTTIAFA--MGYGAT--SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL-ES 319
                 ..|...|:|  .|:|.|  :..:|.....|.: :.|:|.|||.     ::.:..|.| :|
  Fly   137 -----NPPEGNAYARISGWGVTRENNREPAEQVRTTM-VRVLPGAECK-----ISYSGYGQLSDS 190

  Fly   320 QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSS-- 381
            .:||....| ||:|.|||||||..      ||     .:.||.|:|..| |.|:|.|||.|:|  
  Fly   191 MLCAAVRGL-RDSCSGDSGGPLVY------RG-----QVCGIVSWGFGCARPSFPGVYTNVASER 243

  Fly   382 FLDWIELTV 390
            ..::||.|:
  Fly   244 VHEFIEQTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 83/264 (31%)
Tryp_SPc 146..386 CDD:214473 83/263 (32%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 79/243 (33%)
Tryp_SPc 26..251 CDD:238113 82/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.