DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG32834

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:286 Identity:64/286 - (22%)
Similarity:108/286 - (37%) Gaps:93/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DADFDGRVLARPGEYPHMAAVGFESDRGQVDYK----------CGGSLISERFVLTAAHCTSIYE 195
            |.|...|::.           |::.|.....|:          |.|::|:...::|||.|...|.
  Fly    20 DLDAQSRIIG-----------GYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYG 73

  Fly   196 APPKWVRIGDLDLASEKRSVEAQ--LLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV 258
            :..  ||:|     :..|..:..  ||.:.::..||.|....:.:::|||||...::.:|.::|:
  Fly    74 SIE--VRVG-----TSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPI 131

  Fly   259 RL---------WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETP- 313
            .:         |      .|::   |:|:||:.....:|             |...||...:.. 
  Fly   132 SIAEDEPDDGSW------CTVS---GWGSTSWWGSWWDR-------------CFGSLPDYLQMAW 174

  Fly   314 SGVLESQICAQD-------------YIL-----NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIG 360
            ..|...:.||.|             |:.     ....|..|:|.||.::  |:         |:|
  Fly   175 VSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVID--GQ---------LVG 228

  Fly   361 ITSYGVFCRSSYPSVYTRVSSFLDWI 386
            |.|.| .| ::.|.||..|..|..||
  Fly   229 ILSEG-GC-TTKPDVYANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 62/281 (22%)
Tryp_SPc 146..386 CDD:214473 60/279 (22%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 60/278 (22%)
Tryp_SPc 27..255 CDD:238113 61/279 (22%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.