DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and spirit

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:251 Identity:110/251 - (43%)
Similarity:147/251 - (58%) Gaps:23/251 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQ-VDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLA 209
            |.:..||.|:|.|||:|:.|:..| :.|:|||:||:..||||||||..:...||..||:|..:|.
  Fly   134 GGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLT 198

  Fly   210 SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAM 274
                ..|.:.:.|.:|..||:|.....|:|||||:||...:  ..::|..:|...|:..|:..|:
  Fly   199 ----LTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEVTNTLVTAI 257

  Fly   275 GYGATSFAKPMTNRLTNLNLTVVPNAEC--NAELPPLAETPSGVLESQICAQDYILNRDTCQGDS 337
            |||.||||...:.:|..:.|..|.|.||  :.:...||:   |||.:|:||.|....||||||||
  Fly   258 GYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQ---GVLGTQMCAGDITGERDTCQGDS 319

  Fly   338 GGPL--QLNLPGRRRGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTVW 391
            ||||  |..|.|         :::||||.|..|.|..||||||||||:||||..||
  Fly   320 GGPLLMQDGLLG---------YVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 106/245 (43%)
Tryp_SPc 146..386 CDD:214473 105/244 (43%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 108/247 (44%)
Tryp_SPc 132..361 CDD:214473 105/244 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012732
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.