DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG1632

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:370 Identity:66/370 - (17%)
Similarity:123/370 - (33%) Gaps:147/370 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK--WVRIGDLDLASE 211
            ::.||::|.:.|: |..|    .:.|.|:||::.:|||...|   ::..|:  |:.|    :.:.
  Fly   707 MSAPGDWPWLVAL-FRED----IHVCDGTLITQDWVLTTEGC---FQGQPRATWMAI----VGAV 759

  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV------------------ 258
            :.|.:|...:..::..  ..|..:.....||::||..|..:::|||:                  
  Fly   760 RLSAKAPWTQRRRIIG--MIKSPVEGSTAALVRLETPVSYSDHVRPICLPDALQRRLLQQPPAQR 822

  Fly   259 ---------------------------RLWVFPE------------------------------- 265
                                       :.::.|.                               
  Fly   823 RSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASY 887

  Fly   266 LPTTIAFAM---GYGATSFAKPMTNRLTNLN-----------------LTVVPNAE------CN- 303
            :|...|...   ||.....| |..|..::.:                 |..||.|:      || 
  Fly   888 MPKAEALHQELDGYPLPDHA-PQVNYYSSSSTVTSSSTAARIATKAPILAAVPAAQEQIWTNCNT 951

  Fly   304 -----------------AELPPLAETPSGVLESQICAQDYILNRDTCQGD-SGGPLQLNLPGRRR 350
                             .::.| .|..|....:.:|.:......|..|.: ||.|:|..:||..:
  Fly   952 LGWSRQRDHLQRVQLKMGDMAP-CENVSIATVNSMCMEATYQKYDCTQEEYSGAPVQCLIPGTNQ 1015

  Fly   351 GHRIHYHLIGITSYGVFCRSS---YPSVYTRVSSFLDWIELTVWA 392
                 :.|||::|:.:.|..:   .|.:|.:::|...||..|:.|
  Fly  1016 -----WALIGVSSWRIACGPTGVERPRMYDKIASNAAWIRETISA 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 63/363 (17%)
Tryp_SPc 146..386 CDD:214473 62/362 (17%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 28/114 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.