DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss6

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:249 Identity:79/249 - (31%)
Similarity:127/249 - (51%) Gaps:27/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC--TSIYEAPPKW-VRIGDLD 207
            |..::..||:|..|::..   ||:  :.|||:||::|:|:|||||  .....:|..| |.:|  .
  Rat   579 GGAMSSEGEWPWQASLQI---RGR--HICGGALIADRWVITAAHCFQEDSMASPRLWTVFLG--K 636

  Fly   208 LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWV---FPELPTT 269
            :....|.......::.::|.||.:::..:..|:|||:|:..|..:..||||.|..   |.| |..
  Rat   637 MRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFE-PGQ 700

  Fly   270 IAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQ 334
            ..:..|:||.....|.::.|..:::.::|...|| |......||     ..:||......:|.||
  Rat   701 HCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCN-EAYRYQVTP-----RMLCAGYRKGKKDACQ 759

  Fly   335 GDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            |||||||....|..|      :.|.|:.|:|:.| |.::..|||||:..::||:
  Rat   760 GDSGGPLVCKEPSGR------WFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWIQ 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/247 (32%)
Tryp_SPc 146..386 CDD:214473 77/246 (31%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486
Tryp_SPc 576..806 CDD:214473 77/246 (31%)
Tryp_SPc 577..809 CDD:238113 79/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.