DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss9

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001382445.1 Gene:Tmprss9 / 314636 RGDID:1309581 Length:1095 Species:Rattus norvegicus


Alignment Length:345 Identity:99/345 - (28%)
Similarity:150/345 - (43%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADA 139
            |.|||.    ..|.......||..|.........|||.:   |:             |....:|.
  Rat   175 RCEGPV----TERDLKSGHCPGNAFSCQNSQCVSKENPE---CD-------------DRVDCSDG 219

  Fly   140 ND-ADFD----------GRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAH 189
            :| |..|          ||::    |.|||:|...::     |...::.||.::|..|::::|||
  Rat   220 SDEAQCDCGWQPAWRSAGRIVGGAEAAPGEFPWQVSL-----RENHEHFCGATIIGARWLVSAAH 279

  Fly   190 CTSIYEAPPKW-VRIGDLDLA-SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELT 252
            |.:.::.|.:| .:.|.:.|: ||..:|.|::|||.:   ||.|.......|:|:|:|.:.:...
  Rat   280 CFNEFQDPAQWAAQAGSVHLSGSEASAVRARVLRIAK---HPAYNADTADFDVAVLELARPLPFG 341

  Fly   253 EYVRPVRL----WVFPELPTTIAFAMGYGATSF-AKP-----MTNRLTNLNLTVVPNAECNAELP 307
            .||:|..|    .|||.....:....||....| .||     .|..|.:.||       |::.. 
  Rat   342 RYVQPACLPAATHVFPPRKKCLISGWGYLKEDFLVKPEVLQKATVELLDQNL-------CSSLY- 398

  Fly   308 PLAETPSGVLESQICAQDYILNR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RS 370
                 ...:.:..:|| .|:..: |:|||||||||....|..|      :.|.|:.|:|:.| .:
  Rat   399 -----GHSLTDRMVCA-GYLDGKVDSCQGDSGGPLVCEEPSGR------FFLAGVVSWGIGCAEA 451

  Fly   371 SYPSVYTRVSSFLDWI-ELT 389
            ..|.|||||:...||| |:|
  Rat   452 RRPGVYTRVTRLRDWILEVT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/259 (31%)
Tryp_SPc 146..386 CDD:214473 78/257 (30%)
Tmprss9NP_001382445.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.