DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC312273

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:272 Identity:73/272 - (26%)
Similarity:115/272 - (42%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYK---------CGGSLISERFV 184
            ||.:          |.|.|::.           |:......|.|:         ||||||::::|
  Rat    16 FPTE----------DNDDRIVG-----------GYTCQEHSVPYQVSLNAGSHICGGSLITDQWV 59

  Fly   185 LTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEV 249
            |:||||   |. |...||:|:.:: .|....| |.:...::..||:|.|....:||.|:||:...
  Rat    60 LSAAHC---YH-PQLQVRLGEHNI-YEIEGAE-QFIDAAKMILHPDYDKWTVDNDIMLIKLKSPA 118

  Fly   250 ELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPS 314
            .|...|..:.|..:.....|.....|:|...|.....:.|..|:..|:.::.|:...      |.
  Rat   119 TLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKAY------PR 177

  Fly   315 GVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTR 378
            .:..:..|.......:|:||.|||||:..|           ..:.||.|:|..|. ...|.|||:
  Rat   178 QITNNMFCLGFLEGGKDSCQYDSGGPVVCN-----------GEVQGIVSWGDGCALEGKPGVYTK 231

  Fly   379 VSSFLDWIELTV 390
            |.::|:||..|:
  Rat   232 VCNYLNWIHQTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 67/250 (27%)
Tryp_SPc 146..386 CDD:214473 66/249 (27%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.