DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:244 Identity:78/244 - (31%)
Similarity:122/244 - (50%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKRSVEA 217
            ::|...::.|     |..:.||||:|:..:::|||||......|..| |::|.:.|...  .|.:
  Rat   227 QWPWQVSLQF-----QGYHLCGGSVITPLWIVTAAHCVYDLYHPKSWTVQVGLVSLMDS--PVPS 284

  Fly   218 QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMGYGA 278
            .|  :|::..|..||.|...:||||:||.:.:...|.::|:.|    ..||:  ..:.:..|:||
  Rat   285 HL--VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPD--GKLCWTSGWGA 345

  Fly   279 T----SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE-SQICAQDYILNRDTCQGDSG 338
            |    ..|.|:.|...   :.::.|..||..     :...|::. |.:||.......|:||||||
  Rat   346 TEDGAGDASPVLNHAA---VPLISNKICNHR-----DVYGGIISPSMLCAGYLKGGVDSCQGDSG 402

  Fly   339 GPLQLNLPGRRRGHRIHYHLIGITSYGVFCRS-SYPSVYTRVSSFLDWI 386
            |||...       .|..:.|:|.||:|:.|.. :.|.||||::||||||
  Rat   403 GPLVCQ-------ERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/244 (32%)
Tryp_SPc 146..386 CDD:214473 76/242 (31%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055
Tryp_SPc 216..444 CDD:214473 76/242 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.