DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss30

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:275 Identity:86/275 - (31%)
Similarity:140/275 - (50%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC---- 190
            :|...:.||   |:::    |..|::|...::....| |.:   ||||||.|.:|||||||    
Mouse    63 SVCGHSRDA---GKIVGGQDALEGQWPWQVSLWITED-GHI---CGGSLIHEVWVLTAAHCFRRS 120

  Fly   191 --TSIYEAPPKWVRIGDLDLA-SEKRSVEAQLLRIEQVFAHPNYKKKMYYD----DIALLKLEKE 248
              .|.|.     |::|.|.|: .|..|.   |:.:..:|.||.|   ::.|    ||||::|:..
Mouse   121 LNPSFYH-----VKVGGLTLSLLEPHST---LVAVRNIFVHPTY---LWADASSGDIALVQLDTP 174

  Fly   249 VELTEYVRPVRLWV--FPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAE 311
            :..:::. ||.|..  .|..|.|:.:..|:|||. .:.|.:.|..|.:.::.:.:|.........
Mouse   175 LRPSQFT-PVCLPAAQTPLTPGTVCWVTGWGATQ-ERDMASVLQELAVPLLDSEDCEKMYHTQGS 237

  Fly   312 TPSG--VLESQICAQDYIL-NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSY- 372
            :.||  :::|.:....|:. .:|:|||||||||..::       ...:..:||||:|:.|...| 
Mouse   238 SLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSI-------NSSWTQVGITSWGIGCARPYR 295

  Fly   373 PSVYTRVSSFLDWIE 387
            |.|||||.:::|||:
Mouse   296 PGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/261 (31%)
Tryp_SPc 146..386 CDD:214473 81/260 (31%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.