DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:267 Identity:77/267 - (28%)
Similarity:112/267 - (41%) Gaps:75/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEAPPKWVRIGDLDL 208
            |:.|.:|..|::     |.|..:.|||||:|..:|||||||      :|.||     |.:|:|.:
  Rat    36 AQAGAWPWQASL-----RLQKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYE-----VHLGELTI 90

  Fly   209 A-SEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL-----P 267
            . |...|...|::........|...     .||||::|...|.|:..|:||.|   ||.     |
  Rat    91 TLSPHFSTVKQIIMYSSAPGPPGSS-----GDIALVQLATPVALSSQVQPVCL---PEASADFHP 147

  Fly   268 TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPP--LAETPSGVLESQICAQDYILNR 330
            ....:..|:|.|...:|:.                    ||  |.|....|::.:.|:|.|..:.
  Rat   148 GMQCWVTGWGYTQEGEPLK--------------------PPYNLQEAKVSVVDVETCSQAYSSSN 192

  Fly   331 ---------------DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRV 379
                           |.||.||||||...:.|       .:...|:.|:|..| |...|.||.||
  Rat   193 GSLIQSDMLCAWGPGDACQDDSGGPLVCRVAG-------IWQQAGVVSWGEGCGRPDRPGVYARV 250

  Fly   380 SSFLDWI 386
            :::::||
  Rat   251 TAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/267 (29%)
Tryp_SPc 146..386 CDD:214473 75/265 (28%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 75/265 (28%)
Tryp_SPc 30..260 CDD:238113 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.