DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and HABP2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:364 Identity:104/364 - (28%)
Similarity:161/364 - (44%) Gaps:107/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RDIVFPELDAGPGKPEEKMWFHITDFQFDRVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFK--- 107
            :|:.:||                        |.||:|..|        :|         ||.   
Human   279 QDVAYPE------------------------ESPTEPSTK--------LP---------GFDSCG 302

  Fly   108 KKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAA------VGFESD 166
            |.|..:|:         ::||:                |...:..|::|..|:      :.....
Human   303 KTEIAERK---------IKRIY----------------GGFKSTAGKHPWQASLQSSLPLTISMP 342

  Fly   167 RGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVF--AHP 229
            :|   :.|||:||...:||||||||.|.....| |.:||.||  :|.....|..|:|::|  :|.
Human   343 QG---HFCGGALIHPCWVLTAAHCTDIKTRHLK-VVLGDQDL--KKEEFHEQSFRVEKIFKYSHY 401

  Fly   230 NYKKKMYYDDIALLKLEKEVE-----LTEYVRPVRL--WVFPELPTTIAFAMGYGATSFAKPMTN 287
            |.:.::.::||||||| |.|:     .::||:.|.|  ..||.  .:.....|:|.|...|. :.
Human   402 NERDEIPHNDIALLKL-KPVDGHCALESKYVKTVCLPDGSFPS--GSECHISGWGVTETGKG-SR 462

  Fly   288 RLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL-NRDTCQGDSGGPLQLNLPGRRRG 351
            :|.:..:.::.|..||:.  .|.:  ..:.:|.|||.:... .:|||||||||||.....|.   
Human   463 QLLDAKVKLIANTLCNSR--QLYD--HMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGT--- 520

  Fly   352 HRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTV 390
                |::.||.|:|:.| ...|.|||:|:.||:||:.|:
Human   521 ----YYVYGIVSWGLEC-GKRPGVYTQVTKFLNWIKATI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 86/256 (34%)
Tryp_SPc 146..386 CDD:214473 85/255 (33%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 88/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.