DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and GZMB

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_004122.2 Gene:GZMB / 3002 HGNCID:4709 Length:247 Species:Homo sapiens


Alignment Length:270 Identity:77/270 - (28%)
Similarity:130/270 - (48%) Gaps:57/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ADANDADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAP 197
            |||      |.::    |:|...|:||.:.....:..  .:|||.||.:.||||||||       
Human    16 ADA------GEIIGGHEAKPHSRPYMAYLMIWDQKSL--KRCGGFLIRDDFVLTAAHC------- 65

  Fly   198 PKW-----VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
              |     |.:|..::..::.:  .|.:.:::...||.|..|.:.:||.||:||::.:.|..|:|
Human    66 --WGSSINVTLGAHNIKEQEPT--QQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQP 126

  Fly   258 VRL-----WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL 317
            :||     .|.|....::|   |:|.|:.....::.|..:.:||..:.:|.::|....::     
Human   127 LRLPSNKAQVKPGQTCSVA---GWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDS----- 183

  Fly   318 ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSS--YPSVYTRVS 380
            ..::|..|..:.:.:.:|||||||..|...:           ||.|||   |::  .|...|:||
Human   184 TIELCVGDPEIKKTSFKGDSGGPLVCNKVAQ-----------GIVSYG---RNNGMPPRACTKVS 234

  Fly   381 SFLDWIELTV 390
            ||:.||:.|:
Human   235 SFVHWIKKTM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/256 (28%)
Tryp_SPc 146..386 CDD:214473 71/255 (28%)
GZMBNP_004122.2 Tryp_SPc 20..240 CDD:214473 70/254 (28%)
Tryp_SPc 21..243 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.