DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk1c10

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:240 Identity:74/240 - (30%)
Similarity:114/240 - (47%) Gaps:55/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM 235
            :|.|||.||...:|:|||||.|.|    ..|.:|..:|..::..  ||...:.|.|.||:||..:
  Rat    45 EYLCGGVLIDPSWVITAAHCYSNY----YHVLLGRNNLFEDEPF--AQYRFVNQSFPHPDYKPFL 103

  Fly   236 -----------YYDDIALLKLEKEVELTEYVRPVRLWVFPELPT------TIAFAMGYGATSFAK 283
                       |.:|:.||.|.:..::|:.|:.:      :|||      :...|.|:|:|   |
  Rat   104 MRNHTRQRGDDYSNDLMLLHLSEPADITDGVKVI------DLPTEEPKVGSTCLASGWGST---K 159

  Fly   284 PMTNRLTN----LNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLN 344
            |:...|.:    :|:.::.|.:|      :......|.:..:||.:....:|||:|||||||..:
  Rat   160 PLNWELPDDLQCVNIHLLSNEKC------IEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICD 218

  Fly   345 LPGRRRGHRIHYHLIGITSYG-VFCRSSY-PSVYTRVSSFLDWIE 387
                       ..|.||||:| |.|...| |.|||::..|..||:
  Rat   219 -----------GVLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/238 (31%)
Tryp_SPc 146..386 CDD:214473 72/237 (30%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 72/237 (30%)
Tryp_SPc 25..254 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.