DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk1c12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:275 Identity:76/275 - (27%)
Similarity:125/275 - (45%) Gaps:65/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAV--GFESDRG----QV----DYKCGGSLISERFVLTAAHCTSIYEAPPKW 200
            ||:.|.|   |..:.|  |::.::.    ||    .|.|||.||...:|:|||||.| :......
  Rat    13 GRIDAAP---PGQSRVVGGYKCEKNSQPWQVAVINRYLCGGVLIDPSWVITAAHCYS-HALSNYH 73

  Fly   201 VRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM-----------YYDDIALLKLEKEVELTEY 254
            |.:|..:|..::..  ||...:.|.|.||:|....           :.:|:.||.|.:..::|:.
  Rat    74 VLLGRNNLFKDEPF--AQYRFVNQSFPHPDYNPFFMKNHTLFPGDDHSNDLMLLHLSEPADITDG 136

  Fly   255 VRPVRLWVFPELPT------TIAFAMGYGATSFAKPM----TNRLTNLNLTVVPNAECNAELPPL 309
            |:.:      :|||      :...|.|:.:|   ||:    .:.|..:|:.::.|.:|      :
  Rat   137 VKVI------DLPTEEPKVGSTCLASGWSST---KPLEWEFPDDLQCVNINILSNEKC------I 186

  Fly   310 AETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFC-RSSY 372
            ......|.:..:||.:....:|||.|||||||..:           ..|.||||: .|.| .::.
  Rat   187 KAHTQMVTDVMLCAGELEGGKDTCNGDSGGPLLCD-----------GVLQGITSWSSVPCGETNR 240

  Fly   373 PSVYTRVSSFLDWIE 387
            |::||::..|..||:
  Rat   241 PAIYTKLIKFTSWIK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/273 (27%)
Tryp_SPc 146..386 CDD:214473 74/272 (27%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.