DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:248 Identity:71/248 - (28%)
Similarity:121/248 - (48%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD--LDLASEK- 212
            :.|.:|...|: .:.|:    ..|||.|:.|.:|||||||           ::|.  :.|.|:| 
  Rat    33 KEGSHPWQVAL-LKGDQ----LHCGGVLVGESWVLTAAHC-----------KMGQYTVHLGSDKI 81

  Fly   213 RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYG 277
            ....||.::..:.|.||.|..:.:.:||.|:|::|.|::::.|:.|:|....|.|.|:....|:|
  Rat    82 EDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKLPDHCEPPGTLCTVSGWG 146

  Fly   278 ATSFAKPMTNRLTNL---NLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGG 339
            .|:  .|.....::|   ::.::.:.||......|      :.::.:||.......:||.|||||
  Rat   147 TTT--SPDVTFPSDLMCSDVKLISSQECKKVYKDL------LGKTMLCAGIPDSKTNTCNGDSGG 203

  Fly   340 PLQLNLPGRRRGHRIHYHLIGITSYGVF-C-RSSYPSVYTRVSSFLDWIELTV 390
            ||..|           ..|.|:.|:|.: | :.:.|.|||:|..:..|:|.|:
  Rat   204 PLVCN-----------DTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/243 (28%)
Tryp_SPc 146..386 CDD:214473 68/242 (28%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 68/241 (28%)
Tryp_SPc 26..244 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.