DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:242 Identity:70/242 - (28%)
Similarity:113/242 - (46%) Gaps:33/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEA 217
            ||:|..|::.::.     .::||.:||:..::::||||.:.|:.|.:|.       ||...:::.
Human   201 GEWPWQASLQWDG-----SHRCGATLINATWLVSAAHCFTTYKNPARWT-------ASFGVTIKP 253

  Fly   218 QLLR--IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL-----PTTIAFAMG 275
            ..::  :.::..|..||...:..||:|.:|...|..|..|..|.|   |:.     |..:.|..|
Human   254 SKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCL---PDASYEFQPGDVMFVTG 315

  Fly   276 YGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGP 340
            :||........|.|....:|::....||   .|.|.. ..:....:||.......|.||||||||
Human   316 FGALKNDGYSQNHLRQAQVTLIDATTCN---EPQAYN-DAITPRMLCAGSLEGKTDACQGDSGGP 376

  Fly   341 LQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            |..:      ..|..::|.||.|:|..| :.:.|.|||||::..|||
Human   377 LVSS------DARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/242 (29%)
Tryp_SPc 146..386 CDD:214473 68/240 (28%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 70/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.