DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:252 Identity:78/252 - (30%)
Similarity:121/252 - (48%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRG----------QVD--YKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDL 206
            |||.:|.:......|          ||:  :.||.|||..::::|:|||...|:.|..|.     
  Rat   179 EYPRIARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYKNPKLWT----- 238

  Fly   207 DLASEKRSVEAQLL--RIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL--WVFPELP 267
              .|..|::...|.  ::|.:..|.||....:.||||::||...|..:|.:|.|.|  ..|..||
  Rat   239 --VSFGRTLGNPLTTRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFSENLRTVCLPEATFQVLP 301

  Fly   268 TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLES-QICAQDYILNRD 331
            .:..|..|:||.....|..|.|..:.:.::.|..||.     .....|.:.| .|||.......|
  Rat   302 KSKVFVTGWGALKANGPFPNSLQEVEIEIISNDVCNQ-----VNVYGGAISSGMICAGFLTGKLD 361

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            .|:|||||||.::      .:|..::|:||.|:|:.| :.:.|.:||||:.:.:||:
  Rat   362 ACEGDSGGPLVIS------DNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRNWIK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/250 (31%)
Tryp_SPc 146..386 CDD:214473 76/249 (31%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 72/243 (30%)
Tryp_SPc 186..414 CDD:238113 74/245 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.