DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001099352.2 Gene:Tmprss7 / 288118 RGDID:1304655 Length:829 Species:Rattus norvegicus


Alignment Length:306 Identity:77/306 - (25%)
Similarity:124/306 - (40%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LCEQKYSEYVERIFPNDTAVAADAND-ADFDGRVLARPGEYPHMAAVGFESDRGQVDYK------ 173
            :|.:|.:...:.|        .|..| :|.:|...:|...:.|....|.:|..|...::      
  Rat   556 ICFRKQNAQCDGI--------VDCPDRSDEEGCGCSRSSPFLHRVVGGSDSQEGTWPWQVSLHFV 612

  Fly   174 ----CGGSLISERFVLTAAHC--TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYK 232
                ||.|:||..::|:||||  .:....|..|.....:.:....:.|..    :.::..|..|.
  Rat   613 GSAHCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVSP----VRRIVVHEYYN 673

  Fly   233 KKMYYDDIALLKLE---KEVELTEYVRPV-------------RLWVFPELPTTIAFAMGYG---- 277
            .:.:..|||||:|.   .|. |.:.::|:             :.||           .|:|    
  Rat   674 SQTFDYDIALLQLSIAWPET-LRQLIQPICIPPVGQRVRSGEKCWV-----------TGWGRRHE 726

  Fly   278 ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ-ICAQDYILNRDTCQGDSGGPL 341
            |.|...|:   |....:.::....|        .:..|::.|: :||.......|.|:|||||||
  Rat   727 ADSKGSPI---LQQAEVELIDQTVC--------VSTYGIITSRMLCAGVMSGKSDACKGDSGGPL 780

  Fly   342 QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ..     ||.....:.|.||.|:|..| |.::|.||||||:|:.||
  Rat   781 SC-----RRKSDGKWILTGIVSWGYGCGRPNFPGVYTRVSNFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/275 (26%)
Tryp_SPc 146..386 CDD:214473 69/273 (25%)
Tmprss7NP_001099352.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SEA 94..190 CDD:279699
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 6/31 (19%)
Tryp_SPc 591..821 CDD:214473 66/261 (25%)
Tryp_SPc 592..823 CDD:238113 68/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.