DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss3b

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:127/274 - (46%) Gaps:57/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 AVAADANDADFDGRVLARPGEYPHMAAV--GFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEA 196
            |:..|.:|....|....:....|:..::  |:        :.||||||:.::|::||||   |::
  Rat    15 ALPLDDDDDKIVGGYTCQKNSLPYQVSLNAGY--------HFCGGSLINSQWVVSAAHC---YKS 68

  Fly   197 PPKWVRIGD--LDLASEKRSVEA--QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRP 257
            ..: ||:|:  :|:      ||.  |.:...::..||:|....:.:||.|:||.....|...|..
  Rat    69 RIQ-VRLGEHNIDV------VEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVST 126

  Fly   258 VRLWVFPELPT------TIAFAMGYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSG 315
            |      .||.      |.....|:|.| |......:.|..|:..|:.::.|.:..|       |
  Rat   127 V------SLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYP-------G 178

  Fly   316 VLESQICAQDYIL-NRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTR 378
            .:.|.:....::. .:|:||||||||:..|  |:         |.|:.|:|..| :...|.|||:
  Rat   179 KITSNMFCLGFLEGGKDSCQGDSGGPVVCN--GQ---------LQGVVSWGYGCAQKGKPGVYTK 232

  Fly   379 VSSFLDWIELTVWA 392
            |.::::||:.||.|
  Rat   233 VCNYVNWIQQTVAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/255 (27%)
Tryp_SPc 146..386 CDD:214473 68/254 (27%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 68/257 (26%)
Tryp_SPc 25..243 CDD:238113 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.