DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and KLK9

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:249 Identity:85/249 - (34%)
Similarity:121/249 - (48%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSV 215
            ||...|..|.: |...|    ..||.:|||:|::||||||    ..|..|||:|:..|  .|...
Human    30 RPNSQPWQAGL-FHLTR----LFCGATLISDRWLLTAAHC----RKPYLWVRLGEHHL--WKWEG 83

  Fly   216 EAQLLRIEQVFAHPNYKKKM----YYDDIALLKLEKEVELTEYVRPVRL---WVFPELPTTIAFA 273
            ..||.|:...|.||.:.|.:    :.|||.|::|.::..|:..|:|:.|   .|.|.:...|:  
Human    84 PEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLIS-- 146

  Fly   274 MGYGATSFAK---PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQG 335
             |:||.|..|   |:|  |...|::::.|..|:...      |..:.:|.:||..:...|.:|||
Human   147 -GWGAVSSPKALFPVT--LQCANISILENKLCHWAY------PGHISDSMLCAGLWEGGRGSCQG 202

  Fly   336 DSGGPLQLNLPGRRRGHRIHYHLIGITSYGV--FCRSSYPSVYTRVSSFLDWIE 387
            ||||||..|  |.         |.|:.|.|.  ..|...|:|||.|..:||||:
Human   203 DSGGPLVCN--GT---------LAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 84/247 (34%)
Tryp_SPc 146..386 CDD:214473 83/246 (34%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.