DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:304 Identity:94/304 - (30%)
Similarity:142/304 - (46%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFD---------GRVLARPG 153
            |.|.|....::.|..::||..::          ...|.|.|...|...         |...|:.|
Human    33 PSPEPAASSQQAEAVRKRLRRRR----------EGGAHAEDCGTAPLKDVLQGSRIIGGTEAQAG 87

  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVR-IGDLDLASEKRSVEA 217
            .:|.:.::..:..|..| :.|||:|:.||:||||||||.....|..|.. ||..::  ..|....
Human    88 AWPWVVSLQIKYGRVLV-HVCGGTLVRERWVLTAAHCTKDASDPLMWTAVIGTNNI--HGRYPHT 149

  Fly   218 QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL--WVFPELP-TTIAFAMGYGAT 279
            :.::|:.:..|||:..:.|.:||||..|:|.|...:|::|:.|  .||..|. .|..|..|:|.|
Human   150 KKIKIKAIIIHPNFILESYVNDIALFHLKKAVRYNDYIQPICLPFDVFQILDGNTKCFISGWGRT 214

  Fly   280 SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL-ESQICAQDYILNRDTCQGDSGGPLQL 343
            ......||.|.:..:..:....||:|     .:..|:: .:..||.|.....|||:|||||||..
Human   215 KEEGNATNILQDAEVHYISREMCNSE-----RSYGGIIPNTSFCAGDEDGAFDTCRGDSGGPLMC 274

  Fly   344 NLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            .||..:|     :.::||||||..| |..:|.||...|.:..|:
Human   275 YLPEYKR-----FFVMGITSYGHGCGRRGFPGVYIGPSFYQKWL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 84/247 (34%)
Tryp_SPc 146..386 CDD:214473 83/245 (34%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 8/39 (21%)
Tryp_SPc 78..316 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.