DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG33226

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:234 Identity:72/234 - (30%)
Similarity:100/234 - (42%) Gaps:44/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLD----LASEKRSVEAQLLRIEQVFAHPNYKKK 234
            |||||||..||||||||.|.|....::.|...:.    .:|:..|.....:.::::|.|.:|:..
  Fly    72 CGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDY 136

  Fly   235 MYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPN 299
            ..| ||||..|.|.|......||:.:     |.|:....:        :...|.:...|:|....
  Fly   137 HNY-DIALFLLAKPVRYNVQTRPICV-----LQTSNKDKL--------RQFLNYVAMFNVTGWGK 187

  Fly   300 AECNAELPPLAETPSGVLESQICAQDYILNR--------------DTCQGDSGGPL--QLNLPGR 348
            .|.......|..|....|:.:.|||  |.:|              .||.|||||||  :|...|.
  Fly   188 TESQLTSTILQTTSLFHLDRKFCAQ--IFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGV 250

  Fly   349 RRGHRIHYHLIGITSYGV-FCRSSYPSVYTRVSSFLDWI 386
            :|     ..|.||.|||. .||.  .:|:|.|..:.:||
  Fly   251 KR-----TVLFGIISYGAPNCRE--VTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/234 (31%)
Tryp_SPc 146..386 CDD:214473 70/232 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/234 (31%)
Tryp_SPc 47..282 CDD:214473 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.