DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG33459

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:283 Identity:89/283 - (31%)
Similarity:125/283 - (44%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ANDADFDGRVLARP--GEYPHMAAVGFESDRGQV------------DYKCGGSLISERFVLTAAH 189
            ||...:...||..|  |:.|....:....|.|.|            .:.||||||:..|||||||
  Fly    14 ANQLLYGLAVLLEPNCGQIPFRMRIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAH 78

  Fly   190 CTSIYEAPPK--WVRIGDLDLASEKRSVEA----QLLRIEQVFAHPNYKKKMYYDDIALLKLEKE 248
            |..   ..||  .||:|:.|...:..|:..    :...:.:::.||:|:....| |||||||.:.
  Fly    79 CVM---PTPKNLTVRLGEYDWTRQMDSINPKHRHREYMVTRIYTHPSYRSIAAY-DIALLKLNQT 139

  Fly   249 VELTEYVRPVRLWVFPE--------LPTTIAFAM-GYGATSFAKPMTNRLTNLNLTVVPNAECNA 304
            ||.|..:||:.| |.||        :.:...|.: |:|||. .:|::..|.:.|||.:....|:.
  Fly   140 VEYTVAIRPICL-VLPENFHEWYWLVDSVEDFTLTGWGATK-TEPVSQVLQSANLTQIDRGTCHD 202

  Fly   305 ELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR 369
            ..      ...|..:.|||..  .....|.||||.||.:.:...||  .||.. :||.|.|    
  Fly   203 RY------GHSVDHTHICAGS--SKSFACVGDSGSPLAMKVVHNRR--YIHAQ-VGIVSRG---- 252

  Fly   370 SSYP------SVYTRVSSFLDWI 386
               |      :|:|.|.||.:||
  Fly   253 ---PKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 87/276 (32%)
Tryp_SPc 146..386 CDD:214473 85/274 (31%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 80/258 (31%)
Tryp_SPc 38..272 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.