DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG33458

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:247 Identity:78/247 - (31%)
Similarity:113/247 - (45%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK---RSVEAQLLRIE----QVFAHPNY 231
            |||||::..||||||||.....| ...||:|:.| ||:|   ...|.....:|    |...||.|
  Fly    63 CGGSLLNHWFVLTAAHCFRDKNA-KVLVRLGEND-ASQKIDCNESECAAPHLEYMIMQKLIHPLY 125

  Fly   232 KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT---TIAFAM--GYGATSFAKPMTNRLTN 291
            :...|| ||||.||.:.|..|:.:||:.|.:.|....   ||.:.:  |:|||: |..::::   
  Fly   126 RTAHYY-DIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATN-ASEVSDK--- 185

  Fly   292 LNLTVVPNAE---CNAELPPLAETPSGVLESQICA---QDYILNRDTCQGDSGGPLQLNLPGRRR 350
            |.||.:|..:   |......:.:      .:.|||   :.|:     .:|||||||         
  Fly   186 LQLTRIPQIDRFTCRYWFGYMVD------RTHICAGESKHYV-----GKGDSGGPL--------- 230

  Fly   351 GHRIHYHL------IGITS------YGVFCRSSYPSVYTRVSSFLDWIELTV 390
            |..:.|..      .||.|      :||       ||:|.:.|:.:||..|:
  Fly   231 GSMVDYKYAKRFFQFGIVSHLRQPFHGV-------SVFTNILSYSNWIHRTI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/242 (31%)
Tryp_SPc 146..386 CDD:214473 75/241 (31%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 75/241 (31%)
Tryp_SPc 38..274 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.