DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:266 Identity:76/266 - (28%)
Similarity:114/266 - (42%) Gaps:73/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEAPPKWVRIGDLDL 208
            |..|.:|..|::     |....:.|||||:|..:|||||||      :|.|:     |.:|:|  
Mouse    93 APAGTWPWQASL-----RLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQ-----VHLGEL-- 145

  Fly   209 ASEKRSVEAQLLRIEQVFAHPNY---KKKMYY----------DDIALLKLEKEVELTEYVRPVRL 260
                           .|...|::   |:.:.|          .||||::|...|.|:..|:||.|
Mouse   146 ---------------TVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCL 195

  Fly   261 WVFPE-----LPTTIAFAMGYGATSFAKPM--TNRLTNLNLTVVPNAECNAELPPLAETPSGVL- 317
               ||     .|....:..|:|.|...:|:  ...|....::||....|:...    .:|:|.| 
Mouse   196 ---PEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAY----NSPNGSLI 253

  Fly   318 -ESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVS 380
             ...:||:.   ..|.||.||||||...:.|.       :...|:.|:|..| |...|.||.||:
Mouse   254 QPDMLCARG---PGDACQDDSGGPLVCQVAGT-------WQQAGVVSWGEGCGRPDRPGVYARVT 308

  Fly   381 SFLDWI 386
            ::::||
Mouse   309 AYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/266 (29%)
Tryp_SPc 146..386 CDD:214473 74/264 (28%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.