DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F7

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:115/258 - (44%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI----GDL 206
            |..:...||.|..|.:.|..     ...||..|:..|:::|||||   ::...|.|.|    |:.
  Rat   196 GGYVCPKGECPWQAVLKFNE-----ALLCGAVLLDTRWIVTAAHC---FDKFGKLVNITVVLGEH 252

  Fly   207 DLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE---LPT 268
            |. |||...| |:..:|||.....|.:.....||||::|.:.|..|:||.|:.|   ||   ...
  Rat   253 DF-SEKEGTE-QVRLVEQVIMPNKYTRGRTDHDIALVRLHRPVTFTDYVVPLCL---PERAFSEN 312

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVP-----NAECNAELPPLAETPSGVLESQICAQDYIL 328
            |:|.......:.:.:.:....|.|.|.|:.     ..:|.......|.||. :.|:..||.....
  Rat   313 TLASIRFSRVSGWGQLLDRGATALELMVIEVPRLMTQDCLEHAKHSANTPR-ITENMFCAGYMDG 376

  Fly   329 NRDTCQGDSGGPLQLNLPGRRRGHRIHYH----LIGITSYGVFCRS-SYPSVYTRVSSFLDWI 386
            .:|.|:||||||           |..|||    |.|:.|:|..|.: .:..||||||.::||:
  Rat   377 TKDACKGDSGGP-----------HATHYHGTWYLTGVVSWGEGCAAIGHIGVYTRVSQYIDWL 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/258 (31%)
Tryp_SPc 146..386 CDD:214473 79/256 (31%)
F7NP_690059.1 GLA 25..85 CDD:214503
EGF_CA 87..123 CDD:238011
Tryp_SPc 194..430 CDD:238113 80/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.