DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TPSG1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:277 Identity:80/277 - (28%)
Similarity:126/277 - (45%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 ADFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC------TSIYEA 196
            :|..||::    |..|.:|..|::     |.:..:.|||||:|.::|||||||      :|.|: 
Human    57 SDAGGRIVGGHAAPAGAWPWQASL-----RLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQ- 115

  Fly   197 PPKWVRIGDLDLASEKRSVEAQLLRIEQVFAH------PNYKKKMYYDDIALLKLEKEVELTEYV 255
                |.:|:|::     ::......:.|:..|      |...     .||||::|...|.|:..:
Human   116 ----VHLGELEI-----TLSPHFSTVRQIILHSSPSGQPGTS-----GDIALVELSVPVTLSSRI 166

  Fly   256 RPVRLWVFPE-----LPTTIAFAMGYGATSFAKPM--TNRLTNLNLTVVPNAECNAELPPLAETP 313
            .||.|   ||     .|....:..|:|.|...:|:  ...|..:.::||....|..:.|    .|
Human   167 LPVCL---PEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYP----GP 224

  Fly   314 SG-VLE-SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSV 375
            .| :|: ..:||:.   ..|.||.||||||...:.|.       :...|..|:|..| |.:.|.|
Human   225 GGSILQPDMLCARG---PGDACQDDSGGPLVCQVNGA-------WVQAGTVSWGEGCGRPNRPGV 279

  Fly   376 YTRVSSFLDWIELTVWA 392
            ||||.::::||...:.|
Human   280 YTRVPAYVNWIRRHITA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/266 (29%)
Tryp_SPc 146..386 CDD:214473 76/265 (29%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 75/264 (28%)
Tryp_SPc 63..293 CDD:238113 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.