DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk1c2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:130/274 - (47%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAV--GFESDRG----QV----DYKCGGSLISERFVLTAAHC-TSIYEAPPK 199
            ||:.|.|   |..:.:  |::.::.    ||    :|.|||.||...:|:||||| ::.|:    
  Rat    13 GRIDAAP---PGQSRIVGGYKCEKNSQPWQVAVINEYLCGGVLIDPSWVITAAHCYSNNYQ---- 70

  Fly   200 WVRIGDLDLASEKRSVEAQLLRIEQVFAHPNY--------KKKMYYD---DIALLKLEKEVELTE 253
             |.:|..:|..::...:.:|:|  |.|.||:|        .::..:|   |:.||.|.:..::|.
  Rat    71 -VLLGRNNLFKDEPFAQRRLVR--QSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITG 132

  Fly   254 YVRPVRLWVFPELPT------TIAFAMGYGATSFAKPMTNR-LTNLNLTVVPNAECNAELPPLAE 311
            .|:.:      :|||      :...|.|:|:|:.::.:.:. |..:|:.::.|.:|       .|
  Rat   133 GVKVI------DLPTKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKC-------IE 184

  Fly   312 T-PSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGV--FCRSSYP 373
            | ...|.:..:||.:....:|||.|||||||..:           ..|.||||.|.  ..:...|
  Rat   185 TYKDNVTDVMLCAGEMEGGKDTCAGDSGGPLICD-----------GVLQGITSGGATPCAKPKTP 238

  Fly   374 SVYTRVSSFLDWIE 387
            ::|.::..|..||:
  Rat   239 AIYAKLIKFTSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 74/272 (27%)
Tryp_SPc 146..386 CDD:214473 73/271 (27%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 68/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.