DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYK---------CGGSLISERFVLTAAHCTSIYEAPPKWV 201
            |..:|.|.|.......|:......|.|:         ||||||::::|::||||   |::..: |
  Rat    11 GAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHC---YKSRIQ-V 71

  Fly   202 RIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL 266
            |:|:.::  .....:.|.:...::..||||......:||.|:||...|:|...|.||      .|
  Rat    72 RLGEHNI--NVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPV------AL 128

  Fly   267 PTTIAFA------MGYGATSFAKPMTNRLTNLNL------TVVPNAECNAELPPLAETPSGVLES 319
            |:..|.|      .|:|.|     ::|.:.|.:|      .|:..|:|.|..      |..:..|
  Rat   129 PSACAPAGTQCLISGWGNT-----LSNGVNNPDLLQCVDAPVLSQADCEAAY------PGEITSS 182

  Fly   320 QICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFL 383
            .||.......:|:||||||||:..|  |:         |.||.|:|..|. ...|.|||:|.:|:
  Rat   183 MICVGFLEGGKDSCQGDSGGPVVCN--GQ---------LQGIVSWGYGCALPDNPGVYTKVCNFV 236

  Fly   384 DWIELTVWA 392
            .||:.|:.|
  Rat   237 GWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/262 (30%)
Tryp_SPc 146..386 CDD:214473 78/261 (30%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 74/249 (30%)
Tryp_SPc 24..242 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.