DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG30187

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:240 Identity:73/240 - (30%)
Similarity:115/240 - (47%) Gaps:32/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRI 222
            ||||     ..:..:.|||:||.:|||||||||....:       :..:.|.:..:|..|....:
  Fly    50 MAAV-----HNRTHFICGGTLIHKRFVLTAAHCIVDQD-------VQSVSLGAYNKSDPADRKDV 102

  Fly   223 EQVFAHPNYK-KKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIAFAMGYGATSFAKPMT 286
            .....|.::. :..|.:||.||||..:|.....:||:.:.:...:...:.....:.|..:.....
  Fly   103 ITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRG 167

  Fly   287 NRLTNLNLTVVPN----AECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPG 347
            |:.:::..|::.|    .||..|   |:..||   |.||||.  :.:.|||.|||||||..::..
  Fly   168 NKTSDILQTIILNHLDREECYME---LSVYPS---EKQICAG--VPSGDTCGGDSGGPLTNDVFI 224

  Fly   348 RRRGHR-IHYHLIGITSYG-VFCRSSYPSVYTRVSSFLDWIELTV 390
            :..|:| :.:   ||.|.| ..|...  .|||.:.||.|||::|:
  Fly   225 QGIGNREVQF---GIISVGKTSCDGQ--GVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/235 (30%)
Tryp_SPc 146..386 CDD:214473 70/234 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 70/234 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.