DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CG30082

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:229 Identity:74/229 - (32%)
Similarity:110/229 - (48%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGD------LDLASEKRSVEAQLLRIEQVFAHPNY- 231
            |.|:||::|||||||||...:..  ..||:|:      :|..||......:...:|..:.|..: 
  Fly    65 CTGTLITKRFVLTAAHCLHSFHL--LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFG 127

  Fly   232 KKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP-ELPTTIAF-AMGYGATSFAKPMTNRLTNLNL 294
            .::...:||.||||...|....::||:.|:..| ::|.:..: |.|:|........| .|..:||
  Fly   128 GRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTAT-VLQTVNL 191

  Fly   295 TVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLI 359
            ..:..::|...|      .:.:...|.||..:  ..|||.|||||||...:...|....:.   :
  Fly   192 IRLDQSDCERSL------RTSLSYGQFCAGQW--RADTCSGDSGGPLSRKMSNGRITRTVQ---L 245

  Fly   360 GITSYGVF-CRSSYPSVYTRVSSFLDWI-ELTVW 391
            ||.|||.: ||.  |.|||.|.||.:|| .:|.|
  Fly   246 GIVSYGHYLCRG--PGVYTYVPSFTNWILSITRW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/223 (32%)
Tryp_SPc 146..386 CDD:214473 70/221 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 70/221 (32%)
Tryp_SPc 40..274 CDD:238113 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.