DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Cela1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:253 Identity:80/253 - (31%)
Similarity:125/253 - (49%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLAS 210
            |...||...:|...::.:.|. |...:.|||:||...:|:|||||.|  ......|.:||.:| |
  Rat    29 GGAEARRNSWPSQISLQYLSG-GSWYHTCGGTLIRRNWVMTAAHCVS--SQMTFRVVVGDHNL-S 89

  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMY---YDDIALLKLEKEVELTEYVRPVRLWVFPELPTTIA- 271
            :....| |.:.::::..|||:.....   | |||||:|.:.|.|..|   |:|.|.|:..|.:| 
  Rat    90 QNDGTE-QYVSVQKIVVHPNWNSNNVAAGY-DIALLRLAQSVTLNNY---VQLAVLPQEGTILAN 149

  Fly   272 ----FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA-QDYILNRD 331
                :..|:|.|.....::..|....|..|..:.|::.    :...|.|..:.:|| .|.:  |.
  Rat   150 NNPCYITGWGRTRTNGQLSQTLQQAYLPSVDYSICSSS----SYWGSTVKTTMVCAGGDGV--RS 208

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY--GVFCR-SSYPSVYTRVSSFLDWI 386
            .|||||||||...:.|:       |.:.|:||:  .:.|. |..|:|:||||:::.|:
  Rat   209 GCQGDSGGPLHCLVNGQ-------YSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/253 (32%)
Tryp_SPc 146..386 CDD:214473 79/251 (31%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 79/250 (32%)
Tryp_SPc 27..262 CDD:238113 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.