DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Cela3a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:270 Identity:80/270 - (29%)
Similarity:122/270 - (45%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            |.|..:|...::.:|.. |...:.||||||:..:||||.||...|  ....|.:|:.:...|:.|
Mouse    34 AVPHSWPWQVSLQYEMG-GSFHHTCGGSLITPDWVLTAGHCIMPY--LNYRVVLGEHEHGVEEGS 95

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYY--DDIALLKLEKEVELTEYVRPVRLWVFPE----LPT-TIAF 272
            .:...:...::|.||.:..:...  ::|||:||.:..:|.:   .|:|...|.    ||. ...:
Mouse    96 EQVIPINAGELFVHPKWNSECVNCGNNIALVKLSRSAQLGD---AVQLACLPPAGEILPNGAPCY 157

  Fly   273 AMGYGATSFAKPMTNRLTNLNLTVVPNAECN-----AELPPLAETPSGVLESQICAQDYI----L 328
            ..|:|..|...|:..:|....|.||....|:     ...         |..:.:||..||    |
Mouse   158 ISGWGRLSTNGPLPTKLQQALLPVVDYEHCSRWDWWGHY---------VKRTMVCAGGYIQAHSL 213

  Fly   329 NRDT--------CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY----GVFCRS-SYPSVYTRVS 380
            :.||        .|||||||  ||.|......::|    ||.|:    |  |.: ..|:::||||
Mouse   214 SSDTHQPRLLSPLQGDSGGP--LNCPADNGTWQVH----GIASFVSPSG--CNTLKKPTMFTRVS 270

  Fly   381 SFLDWIELTV 390
            :|:||||.|:
Mouse   271 AFIDWIEETI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/265 (29%)
Tryp_SPc 146..386 CDD:214473 76/264 (29%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 76/264 (29%)
Tryp_SPc 28..279 CDD:238113 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.