DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Acr

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_036622.2 Gene:Acr / 24163 RGDID:2024 Length:437 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:124/266 - (46%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVG-FESDRGQVDYKCGGSLISERFVLTAAHC----TSIYEAPPKWVRI-- 203
            |...:.||.:|.|.::. |.|...:..:.|||||::..:|||||||    ..:|:    |..:  
  Rat    45 GGQTSSPGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYD----WRLVFG 105

  Fly   204 -GDLDLASEKRSVEAQLLR-IEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVF--- 263
             .:::....|...|.|..| ::::..|..|......:||||||:...|...::|.|..|..|   
  Rat   106 AHEIEYGRNKPVKEPQQERYVQKIVIHEKYNAVTEGNDIALLKVTPPVTCGDFVGPGCLPHFKSG 170

  Fly   264 -PELPTTIAFAMGYGATSFAKP------MTNRLTNLNLTVVPNAECNAELPPLAETPSG-VLESQ 320
             |.:|.| .:..|:|......|      |..|:..::|.:     ||:     .:..:| |..:.
  Rat   171 PPRIPHT-CYVTGWGYIKDNAPRPSPVLMEARVDLIDLDL-----CNS-----TQWYNGRVTSTN 224

  Fly   321 ICAQDYILNRDTCQGDSGGPL----QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVS 380
            :||.......|||||||||||    .::.|         :.::||||:||.| |:..|.|||...
  Rat   225 VCAGYPEGKIDTCQGDSGGPLMCRDSVDSP---------FVIVGITSWGVGCARAKRPGVYTATW 280

  Fly   381 SFLDWI 386
            .:||||
  Rat   281 DYLDWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 81/266 (30%)
Tryp_SPc 146..386 CDD:214473 79/264 (30%)
AcrNP_036622.2 Tryp_SPc 42..286 CDD:214473 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.