DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and PRSS54

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:266 Identity:51/266 - (19%)
Similarity:89/266 - (33%) Gaps:75/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLD 207
            :|...|..:..:|.|:|.               |.::||.:||:.|  ::|.......|.:|..:
Human    52 EFPWVVSLQDSQYTHLAF---------------GCILSEFWVLSIA--SAIQNRKDIVVIVGISN 99

  Fly   208 LASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV-------------- 258
            :...|  :......:..:..|.::......::|||||.:..:.....|:.:              
Human   100 MDPSK--IAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPPVLQ 162

  Fly   259 RLWVFPELPTTIAFAMGYGATS--FAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQI 321
            ..||....||:   |.|...|.  ..|.....|....|..:...||.:......:|         
Human   163 NCWVSGWNPTS---ATGNHMTMSVLRKIFVKDLDMCPLYKLQKTECGSHTKEETKT--------- 215

  Fly   322 CAQDYILNRDTCQGDSGGPL-----QLNLPGRRRGHRIHYHLIGITSY-GVFCRSSYPSVYTRVS 380
                      .|.||.|.|:     |.:|          :.|.|:.:: |..|...:  :||:|.
Human   216 ----------ACLGDPGSPMMCQLQQFDL----------WVLRGVLNFGGETCPGLF--LYTKVE 258

  Fly   381 SFLDWI 386
            .:..||
Human   259 DYSKWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 50/263 (19%)
Tryp_SPc 146..386 CDD:214473 48/261 (18%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 49/264 (19%)
Tryp_SPc 52..264 CDD:238113 49/264 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.