DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F11

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:408 Identity:108/408 - (26%)
Similarity:155/408 - (37%) Gaps:81/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CLSNTHTQRLPPE--GRMRPLQDDSIRS-----PV--------DRDIVFPELDAGPGKPEE---K 63
            ||..|....||..  .:.:.|...|::|     ||        |.|.:..|||....|..|   |
Human   255 CLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQK 319

  Fly    64 MWFHITDFQF-----------DRVEGPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLC 117
            :..:....||           :...|....|......|...:.|:      ||.   .....|||
Human   320 LCTNAVRCQFFTYTPAQASCNEGNRGKCYLKLSSNGSPTKILHGR------GGI---SGYTLRLC 375

  Fly   118 EQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISER 182
            :.. :|...:|.|......|...            ||:|....:...|...:  :.||||:|..:
Human   376 KMD-NECTTKIKPRIVGGTASVR------------GEWPWQVTLHTTSPTQR--HLCGGSIIGNQ 425

  Fly   183 FVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEK 247
            ::||||||....|: ||.:|:....|...:...:.....::::..|..||......||||||||.
Human   426 WILTAAHCFYGVES-PKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLET 489

  Fly   248 EVELTEYVRPVRLWVFPELPT--------TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNA 304
            .|..|:..||:.      ||:        |..:..|:|.......:.|.|....:.:|.|.||..
Human   490 TVNYTDSQRPIC------LPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQK 548

  Fly   305 ELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC- 368
            ..     ....:....|||......:|.|:|||||||...       |...:||:||||:|..| 
Human   549 RY-----RGHKITHKMICAGYREGGKDACKGDSGGPLSCK-------HNEVWHLVGITSWGEGCA 601

  Fly   369 RSSYPSVYTRVSSFLDWI 386
            :...|.|||.|..::|||
Human   602 QRERPGVYTNVVEYVDWI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/250 (30%)
Tryp_SPc 146..386 CDD:214473 73/248 (29%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519 7/27 (26%)
APPLE 291..375 CDD:128519 17/92 (18%)
Tryp_SPc 388..619 CDD:214473 74/263 (28%)
Tryp_SPc 389..619 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.