DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and F2

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:403 Identity:102/403 - (25%)
Similarity:154/403 - (38%) Gaps:119/403 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PGKPEEKMWFHIT----DFQF----------------------DR-VEGPTQPKPKPRQYPPPPM 94
            |...||.:|.::.    ||.:                      || :||.|........:.|...
Human   265 PDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTF 329

  Fly    95 PG-------QPFPPPPGGFKKK--ENKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVL- 149
            ..       :|.      |:||  |:|..|...:.|                      .|||:: 
Human   330 GSGEADCGLRPL------FEKKSLEDKTERELLESY----------------------IDGRIVE 366

  Fly   150 ---ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW----------V 201
               |..|..|....:..:|.:   :..||.||||:|:|||||||. :|   |.|          |
Human   367 GSDAEIGMSPWQVMLFRKSPQ---ELLCGASLISDRWVLTAAHCL-LY---PPWDKNFTENDLLV 424

  Fly   202 RIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD-DIALLKLEKEVELTEYVRPVRLWVFPE 265
            |||.......:|::| ::..:|:::.||.|..:...| ||||:||:|.|..::|:.||.|   |:
Human   425 RIGKHSRTRYERNIE-KISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCL---PD 485

  Fly   266 LPTTIAF--------AMGYG------ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGV 316
            ..|..:.        ..|:|      ..:..|...:.|..:||.:|....|.      ..|...:
Human   486 RETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCK------DSTRIRI 544

  Fly   317 LESQICA---QDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYT 377
            .::..||   .|.....|.|:||||||..:..|...|     ::.:||.|:|..| |......||
Human   545 TDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNR-----WYQMGIVSWGEGCDRDGKYGFYT 604

  Fly   378 RVSSFLDWIELTV 390
            .|.....||:..:
Human   605 HVFRLKKWIQKVI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/273 (29%)
Tryp_SPc 146..386 CDD:214473 79/272 (29%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527 6/27 (22%)
Thrombin_light 317..363 CDD:286482 10/73 (14%)
Tryp_SPc 363..613 CDD:214473 78/271 (29%)
Tryp_SPc 364..616 CDD:238113 79/273 (29%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.