DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CELA1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001962.3 Gene:CELA1 / 1990 HGNCID:3308 Length:258 Species:Homo sapiens


Alignment Length:261 Identity:80/261 - (30%)
Similarity:125/261 - (47%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI--GDLDL 208
            |...|....:|...::.:.|. |...:.|||:||.:.:|:|||||.. |:   |..|:  ||.:|
Human    21 GGTEAGRNSWPSQISLQYRSG-GSRYHTCGGTLIRQNWVMTAAHCVD-YQ---KTFRVVAGDHNL 80

  Fly   209 ASEKRSVEAQLLRIEQVFAHPNYKKKMYYD--------DIALLKLEKEVELTEYVRPVRLWVFPE 265
             |:....| |.:.::::..||      |::        |||||:|.:.|.|..|   |:|.|.|:
Human    81 -SQNDGTE-QYVSVQKIVVHP------YWNSDNVAAGYDIALLRLAQSVTLNSY---VQLGVLPQ 134

  Fly   266 LPTTIA-----FAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICA-Q 324
            ....:|     :..|:|.|.....:...|....|..|..|.|::.    :...|.|..:.:|| .
Human   135 EGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSS----SYWGSTVKNTMVCAGG 195

  Fly   325 DYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR----SSYPSVYTRVSSFLDW 385
            |.:  |..|||||||||...:.|:       |.:.|:||: |..|    |..|:|:|:||:::.|
Human   196 DGV--RSGCQGDSGGPLHCLVNGK-------YSVHGVTSF-VSSRGCNVSRKPTVFTQVSAYISW 250

  Fly   386 I 386
            |
Human   251 I 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/261 (31%)
Tryp_SPc 146..386 CDD:214473 78/259 (30%)
CELA1NP_001962.3 Tryp_SPc 19..254 CDD:238113 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.