DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk6

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001158168.1 Gene:Klk6 / 19144 MGIID:1343166 Length:253 Species:Mus musculus


Alignment Length:221 Identity:67/221 - (30%)
Similarity:106/221 - (47%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEA--QLLRIEQVFAHPNYKKKMY 236
            |||.||..::|||||||    :.|...|.:|..:|    |..|.  :.:.:::...||.|..:.:
Mouse    54 CGGVLIDPQWVLTAAHC----KKPNLQVILGKHNL----RQTETFQRQISVDRTIVHPRYNPETH 110

  Fly   237 YDDIALLKLEKEVELTEYVRPVRLW--VFPELPTTIAFAMGYGATSFAK-PMTNRLTNLNLTVVP 298
            .:||.::.|:..|:.::.::|:.|.  ...|.|.  ...:|:|...... |.|.:..:::|  ||
Mouse   111 DNDIMMVHLKNPVKFSKKIQPLPLKNDCSEENPN--CQILGWGKMENGDFPDTIQCADVHL--VP 171

  Fly   299 NAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITS 363
            ..:|....      |..:.:|.:||.|.....|:|||||||||...  ||.|         |:.|
Mouse   172 REQCERAY------PGKITQSMVCAGDMKEGNDSCQGDSGGPLVCG--GRLR---------GLVS 219

  Fly   364 YG-VFCRS-SYPSVYTRVSSFLDWIE 387
            :| :.|.| ..|.|||.|.:.:.||:
Mouse   220 WGDMPCGSKEKPGVYTDVCTHIRWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 66/219 (30%)
Tryp_SPc 146..386 CDD:214473 65/218 (30%)
Klk6NP_001158168.1 Tryp_SPc 28..244 CDD:214473 65/218 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.