DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Mcpt8

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_032598.1 Gene:Mcpt8 / 17231 MGIID:1261780 Length:247 Species:Mus musculus


Alignment Length:249 Identity:70/249 - (28%)
Similarity:119/249 - (47%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRS 214
            ::|...|:||.:.|...:..  |:|||.|::...|:|||||..      |.:.: .|.:.:.|:.
Mouse    27 SKPHSRPYMAYIRFNDSKSV--YRCGGFLVARDIVMTAAHCNG------KVINV-TLGIHNLKKK 82

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL-----WVFPELPTTIAFAM 274
            ...||:.:.:...|.::..:...:||.|||||::.:|...|..:.|     ||.|....|:|   
Mouse    83 KNTQLIPVSEAIPHESFDNETLVNDIMLLKLERKAQLNSAVDTIALPKSKDWVKPGQVCTVA--- 144

  Fly   275 GYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGG 339
            |:|..:.. .:::.|..:||.|....:|.:    :::|.:..:  |:|..:...|:.|.:|||||
Mouse   145 GWGKLANC-TLSDTLQEVNLEVQKGQKCRS----MSQTYNDSI--QLCVGNPSENKATGKGDSGG 202

  Fly   340 PLQLNLPGRRRGHRIHYHLIGITSYGVFCR---SSYPSVYTRVSSFLDWIELTV 390
            |...|               |:....|.||   .:.|.|:||:|||:.||..|:
Mouse   203 PFVCN---------------GVVQGIVSCRLCTGTLPRVFTRISSFMPWIRKTM 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 68/244 (28%)
Tryp_SPc 146..386 CDD:214473 67/243 (28%)
Mcpt8NP_032598.1 Tryp_SPc 20..237 CDD:214473 67/243 (28%)
Tryp_SPc 21..240 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.