DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Gzmm

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:269 Identity:76/269 - (28%)
Similarity:121/269 - (44%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIG 204
            |:.:::    |.|...|:||::  :..:..|   |||.|:..::|||||||.|    .|    :.
Mouse    23 FETQIIGGREAVPHSRPYMASL--QKAKSHV---CGGVLVHRKWVLTAAHCLS----EP----LQ 74

  Fly   205 DLDLASEKRSVE-----AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP 264
            :|.|.....::.     .....|.:...||.|..| |.:|:|||||::.|:.::.|:|:.|   |
Mouse    75 NLKLVLGLHNLHDLQDPGLTFYIREAIKHPGYNHK-YENDLALLKLDRRVQPSKNVKPLAL---P 135

  Fly   265 ELPT------TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL-ESQIC 322
            ..|.      |.....|:|.|....|....|..|:|.|:....||.     :...:||| :|.:|
Mouse   136 RKPRSKPAEGTWCSTAGWGMTHQGGPRARALQELDLRVLDTQMCNN-----SRFWNGVLIDSMLC 195

  Fly   323 AQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSY-GVFCRSSY-PSVYTRVSSFLDW 385
            .:....::..|:|||||||...     :|     .:.||.|: ...|...: |.|.|.|:.:..|
Mouse   196 LKAGSKSQAPCKGDSGGPLVCG-----KG-----QVDGILSFSSKTCTDIFKPPVATAVAPYSSW 250

  Fly   386 IELTV--WA 392
            |...:  |:
Mouse   251 IRKVIGRWS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/258 (28%)
Tryp_SPc 146..386 CDD:214473 72/257 (28%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 74/258 (29%)
Tryp_SPc 27..251 CDD:214473 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.