DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klk1b1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:315 Identity:84/315 - (26%)
Similarity:128/315 - (40%) Gaps:102/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PP------GGFKKKENKQR-RLCEQKYSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMA 159
            ||      ||||.::|.|. .:...:|.||:                                  
Mouse    19 PPVQSRIVGGFKCEKNSQPWHVAVYRYKEYI---------------------------------- 49

  Fly   160 AVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQ 224
                          |||.|:...:|||||||  .||....|  :|..:|..::.|.:.:|  :.:
Mouse    50 --------------CGGVLLDANWVLTAAHC--YYEKNNVW--LGKNNLYQDEPSAQHRL--VSK 94

  Fly   225 VFAHPNYKKKM-----------YYDDIALLKLEKEVELTEYVRPVRL-WVFPELPTTIAFAMGYG 277
            .|.||.|...:           |..|:.||:|.|..::|:.|:|:.| ...|:|.:| ..|.|:|
Mouse    95 SFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGST-CLASGWG 158

  Fly   278 AT-----SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDS 337
            :.     .:||.    |..:||.::||.:|:...      ...|.:..:||......:|||:|||
Mouse   159 SIIPVKFQYAKD----LQCVNLKLLPNEDCDKAY------VQKVTDVMLCAGVKGGGKDTCKGDS 213

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVF-C-RSSYPSVYTRVSSFLDWIELTV 390
            ||||..:           ..|.|:||:|.. | ....|.|||::..|..||:.|:
Mouse   214 GGPLICD-----------GVLQGLTSWGYNPCGEPKKPGVYTKLIKFTSWIKDTL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 71/259 (27%)
Tryp_SPc 146..386 CDD:214473 70/258 (27%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 79/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.