DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Klkb1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:261 Identity:82/261 - (31%)
Similarity:119/261 - (45%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GRVLARPGEYPHMAAVGFESDRGQV-----DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGD 205
            |...|..||:|...::       ||     .:.||||:|..::|||||||......|..|...|.
Mouse   393 GGTNASLGEWPWQVSL-------QVKLVSQTHLCGGSIIGRQWVLTAAHCFDGIPYPDVWRIYGG 450

  Fly   206 LDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT-- 268
            : |:..:.:.|....||:::..|..||......||||:||:..:..||:.:|:.|....:..|  
Mouse   451 I-LSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQKPICLPSKADTNTIY 514

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNR--- 330
            |..:..|:|.|.......|.|....:.:|||.||..:.                 :||::|:   
Mouse   515 TNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKKY-----------------RDYVINKQMI 562

  Fly   331 ---------DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDW 385
                     |.|:|||||||.....||       :.|:||||:|..| |...|.|||:||.::||
Mouse   563 CAGYKEGGTDACKGDSGGPLVCKHSGR-------WQLVGITSWGEGCARKDQPGVYTKVSEYMDW 620

  Fly   386 I 386
            |
Mouse   621 I 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/261 (31%)
Tryp_SPc 146..386 CDD:214473 80/259 (31%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 80/259 (31%)
Tryp_SPc 391..621 CDD:238113 80/259 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.